Public Discord Servers and Bots

gaming 19,051 community 16,862 anime 8,666 social 7,771 roleplay 5,031 music 3,656 games 3,338 art 3,218 friends 3,148 memes 3,041 hangout 2,649 giveaways 2,312 crypto 1,769 manga 1,365 furry 1,149 lgbtq 1,075 emotes 920 csgo 755 programming 738 helldivers2 94 gta v 90 arc raiders 73 duneawakening 17

More Tags

ZTRADEZ Options Trading

Financial | Investing | Trading

Join a stock market options trading stock trading discord server with over 41,000 like minded individuals. We are discussing the next market move 24 hours a day, 7 days a week. Get trade signals around the clock!

Join Now

ZTRADEZ Options Trading Discord Server Banner

ZTRADEZ Options Trading

Financial | Investing | Trading

SEO Community Deutschland

Community | Education

Willkommen bei der SEO Community Deutschland, dem führenden deutschen Discord-Server für Suchmaschinenoptimierung und Online-Marketing! Dieser Server wurde speziell für Profis und Neulinge im Bereich SEO und Online-Marketing geschaffen. Hier findest du eine Gemeinschaft von SEO-Experten, Digitale Marketer, Content-Ersteller, und Unternehmen, die ihre Fähigkeiten in den Bereichen Suchmaschinenoptimierung und digitales Marketing weiterentwickeln möchten. Bei der SEO Community Deutschland können Sie: Die neuesten Trends und Techniken im Bereich SEO und Online-Marketing kennenlernen und diskutieren. Mit erfahrenen Profis zusammenarbeiten und Ratschläge für Ihre Projekte erhalten. Lernen, wie Du die Sichtbarkeit deiner Website verbessern und mehr qualifizierten Traffic generieren kannst. Praktische Anleitungen und Ressourcen erhalten, um Ihre SEO- und Online-Marketing-Fähigkeiten zu verbessern. Unser Ziel ist es, eine freundliche, hilfsbereite und professionelle Atmosphäre zu schaffen, i

Fluffy's Domain

Streaming | LGBT

Fluffy's Domain is a new Discord server that focuses on the furry community, as well as gaming, and streaming! Here are some of the features we offer! Gaming - We have lots of furs willing and wanting to game & stream! SFW - We are a safe for work server, open to all ages (13 and above)! Reaction Roles - We have all kinds of custom reaction roles! Active Mods - We have a strong and active team of moderators to keep our server nice and clean! We hope to see you around Fluffs~!

PrideTuve - DE | LGBTQIA+

Gaming | LGBT

LGBTQIA+ | Minecraft | Community - Wir sind ein Discord-Server auf dem es hauptsächlich um LGBTQIA+ geht. Wir wollen einen sicheren Discord-Server für alle aus der LGBTQIA+ Community garantieren. Wir sind auch dabei, einen Minecraft-Server aufzubauen und würden uns freuen, wenn du uns dabei unterstützen möchtest (Builder, Tester*in...) -> Das bauen des Servers kann aber noch eine Weile dauern. Wir freuen uns darauf, dich kennenzulernen :D Was es alles auf unserem Server gibt: 🡲 self roles mit /myprofile Befehl 💻. 🡲 Spiele wie TicTacToe 🡲 lgbtqia+ safe space 🏳️‍🌈 🡲 trans chat - ein trans chat zum Austausch, für Fragen oder für Hilfe ️‍⚧️ 🡲 School Chat, Music Lounge, Pride Lounge und vieles mehr 📚🎵🏳️‍🌈 🡲 Ticket-Support für Fragen zum Discord/Minecraft-Server oder auch Fragen zu lgbtqia+.... 🎫 🡲 Ab und zu Minecraft-Events 🡲 Du kannst immer neue Ideen/Verbesserungen für den Discord oder Minecraft-Server vorschlagen. 🡲 und vieles mehr 🥰.

Ætheria

Community | Gaming

Bienvenue sur Ætheria, un lieu convivial où la communauté se réunit pour discuter, partager des astuces et des stratégies, et bien sûr, jouer ensemble à des jeux populaires tels que Minecraft, Among Us, Valorant, Rocket League et bien d'autres encore. Notre serveur est plus qu'un simple endroit pour jouer à des jeux, c'est une communauté chaleureuse où les membres peuvent discuter de leurs intérêts communs, tels que les jeux-vidéos, le cinéma, la musique et bien plus encore. Nous sommes ouverts aux partenariats avec d'autres serveurs pour créer une communauté soudée où les membres peuvent créer des liens d'amitié avec les autres joueurs. Nous organiserons également des événements spéciaux à la demande des membres, tels que des giveaways lorsque nous le pourront. Rejoignez notre communauté et faites vous des amis, trouvez des partenaires pour jouer aux jeux qui vous font kiffer et profitez d'une expérience agréable et amusante qui vous plairais sûrement !

SirIzaakTV😊💖🔥

Community | Entertainment

SirIzaak's Spot, your chill spot where the good times never end and the vibes are just right! Here, we're all about sharing smiles and laughter, building connections, and making memories in an intimate, friendly environment. From late-night voice chats where we share stories, to live video sessions

CRC Gaming

Gaming | Social

a gaming/clan/chat for fun server it has giveaways weekly and our channel releases videos once a week we have roblox valorant ovewatch fortnite rocket league and more come check us out!

HomeWorks

Education | Writing

Welcome to Homework server for all Students , Welcome to Homework server for all Students , Welcome to Homework server for all Students

Holland's Anime and Manga Club

Anime | Community

HAAMC, de Nederlandstalige anime en manga club voor Nederland en Belgie. | The Dutch anime and manga club for the Netherlands and Belgium. | NL & BE chat. | Oorspronkelijk vanaf MyAnimeList met 2000 members, nu ook op discord met 1200+ members. | Maandelijkse meetings, cosplay, competities, conventies, seasonal anime, muziek, games en meer!

Overwatch Cavalry

Gaming | eSports

Welcome to the Overwatch Cavalry server. Join for news, giveaways, LFG and more.

La Cavalerie Overwatch

Gaming | Community

Plus grand serveur francophone Overwatch. Actualités, concours, outils de recherche, scrims et plus encore !

Playergency

Gaming | Community

Masz dość gry w samotności? Nie chce Ci się wciąż wpisywać w necie "szukam ludzi do gry"? A może chcesz miło spędzić czas rozmawiając z ciekawymi ludźmi? W takim razie chciałbym Ciebie bardzo serdecznie zaprosić do grupy Playergency.

Chess University

Education | Community

🏆 Join Our Chess Discord Server and Elevate Your Game! 🏆 Hope you're doing well! I wanted to share something amazing with you - our active and engaging chess Discord server. Here's why you should join: Level Up Your Skills: Connect with players of all levels, from beginners to grandmasters. Get valuable feedback, learn new strategies, and enhance your gameplay. Supportive Community: Experience a friendly and inclusive environment where you can ask questions, discuss favourite openings, and interact with like-minded chess enthusiasts. Thrilling Tournaments: Participate in exciting chess tournaments, challenges, and events. Showcase your skills, compete, and learn from talented players. Abundant Resources: Access a wealth of chess resources, including books, videos, puzzles, and articles. Receive game analysis and guidance from experienced players. Build Lasting Connections: Meet fellow chess lovers.

Anime Sekai

Anime | Community | Gaming

Laid back 16+ Anime, Manga & Novels Server! Everyone is welcome so feel free to drop by and say hello! 🌸 500 anime emotes🌸 Active chat 🌸🌸 Giveaways 🌸

Join Now

Anime Sekai

Anime | Community | Gaming

Laid back 16+ Anime, Manga & Novels Server! Everyone is welcome so feel free to drop by and say hello! 🌸 500 anime emotes🌸 Active chat 🌸🌸 Giveaways 🌸

City of Niepan

Role-Playing | Gaming

20+ Genshin town au rp (featuring a local university) with plenty of open characters and a lot of fun to be had! nsfw will exist but in muteable channels so you can sort of choose your own adventures. we're considering opening up to honkai star rail characters as well, so come check us out!

Riottriott server

Community | Financial

HD Refs, make some money with Home Depot cheap and quick. Telegram @riotriott Discord riottriott#6755

Aquarium Community

Community | Hobbies

Aquarium Community is an international server open to all. We welcome anyone who has a passion for fish keeping & aquariums. This is a server for all things related to fish and even semi-aquatic creature keeping. All water parameters are allowed freshwater, saltwater and brackish (Terrariums, paludariums, and vivariums welcome as well). Just no snakes or dry land reptiles please. We are the largest discord server in the hobby with over 4500 members and counting. This is a friendly and judgement free area which we have an admin/mod team which makes sure it stays this way, please feel welcome to join us!

Omni Underground

Music | Community

Music, EDM, House, Drum&Bass, Party, Connect.

The Supreme Paradise

Entertainment | Furry

This Server Has almost 300 Members. Our Server Is Specially Known For Activities and wonderful bots. There are nice people to meet up. We dont support any kind of NSFW. If you want to join now click the joining button and be a part of our supreme paradise.

ERRORS KINGDOM

Gaming | Community

Seeking a place to share your thoughts & creations? Creative Thoughts is all about collaborating, sharing, conversation, and more! We have a wide variety of topics however we’re always listening to suggestions from the community. 🤖 Custom-coded bots! 🎉 Regular events & giveaways! 😆 Global Emotes! 🎮 For playing games like minecraft,roblox,valorant and many more games Join Now! https://discord.gg/DDKwbEDEmc

Discord Scam Watch

Social | Community

Discord Scam Watch - News about the latest Discord scams. Here is some filler text for the character limit.

The_Raverbreak_Collective

Music | Social

This server is meant for promoting underground rave style music. Housing plenty of genres and creative minds, this server is a music collective/group of individuals looking to share their music all in one spot. This includes but isn't limited to: breakcore, speedcore, dancecore, hardcore, gabber, and plenty more.

StreamAwaiter

Bot | Anime

Welcome to the StreamAwaiter Bot Support and Community Server, where we elevate your streaming experience to new heights! Whether you're a seasoned streamer, an aspiring content creator, or a dedicated viewer, our server is the ultimate hub for StreamAwaiter bot enthusiasts. Are you using StreamAwaiter bot and need expert support? Look no further! Our dedicated support team and experienced community members are here to provide comprehensive assistance. From troubleshooting technical issues to helping you master bot commands, we'll ensure that you get the most out of StreamAwaiter's powerful features. Rest assured that no matter the challenge you face, our friendly community will guide you towards success.

Vodka's Server

Community | Entertainment

This server is for vodka lovers, you will find the username: Vodka#0001 in this server and you will also find his home made stickers that you wont regret looking at. In this server we speak English and Russia

🍝﹒⺌﹒ UKIYO !!

Entertainment | Community

Our server is based on decors, making friends, etc. We have lots of bots and cool stuff that you could have fun with !

Stardew Valley Indonesia

Community | Gaming

mau mabar Stardew valley? kuy join mabar kita :) KITA TIDAK PUNYA GROUP FACEBOOK ATAU LAIN-LAIN. KITA HANYA DI DISCORD. JIKA ADA YANG MENGATAKAN SERVER KAMI DARI FACEBOOK, MOHON MAAF KAMI TIDAK SUKA NAMA KOMUNITAS KAMI DI GUNAKAN UNTUK KOMUNITAS CRACKER SDV SEPERTI KALIAN Perlu diketahui server ini bukanlah server official dan sudah affiliate dengan server community untuk kita saling terhubung dan bermain bersama.

Identification

Education | Growth | Social

Laid-back, education-focused community examining MBTI and Enneagram theories for self-discovery. 500 animal emotes. MBTI guild tag. Daily movies and VCs. Make collages together.

Join Now

Identification

Education | Growth | Social

Laid-back, education-focused community examining MBTI and Enneagram theories for self-discovery. 500 animal emotes. MBTI guild tag. Daily movies and VCs. Make collages together.

Indonesian Weebs Community

Anime | Memes

Gak dapet info Manga dan Anime? ▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬ Kesini aja, disini kami semua membicarakan tentang Manga dan komik, disediakan juga RSS yang up-to-date tentang Informasi manga dan Komik secara 24 jam ▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬ RSS yang tersedia: > Mangakita > Bacakomik > Animanga (Journal otaku) > Web Novel > West Manga ▬ > Anime News Network > Jurnal Otaku > Crunchyroll > Kadokawa > Livecharts ▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬

Cozy Cove

Community | Social

Hiya! We are a brand new SFW 18+ community based on an ocean town theme. 🌊 We have a level system, plenty of bots to choose from, and lots of channels for you to post in! We are aiming to build up a brand new community from scratch, a safe space for adults all over the world to come together and make connections. We offer: - a level locked NSFW channel - bots like PokéTwo and WaifuGame - creative contests for anyone to join - custom roles to choose from - a fun ocean town theme! We can’t wait to meet you at Cozy Cove 🐠🦑🌊

BACK DOOR BANDITS PVP

Gaming | Social

We're a group of like-minded players who love to explore Azeroth, take on dungeons, and mostly indulge in casual and ranked PvP! Whether you're a seasoned veteran or a newcomer to the game, we welcome you to join our ranks and share in the adventure. Our focus is on having fun and building a supportive community, so don't be afraid to ask for help or share your own knowledge with others. We look forward to seeing you in-game! EU REALM RUNTETOTEM (GBR) All nations welcome!

CALAMITY CREW

Gaming | Anime

Join our Discord server for Rell Seas, the upcoming Roblox game inspired by One Piece and created by Rell Games. Set sail on a new anime pirate adventure and stay up-to-date with the latest news and updates. Share your excitement with other fans and get ready for the release in 2023!

Swift Logistics

Gaming | Community

Server Description Swift Logistics is an international vtc founded in May 12 2023, here our goal is to have fun and have a good experience with our drivers. HOW TO APPLY? To join our vtc you need to follow a few simple steps, visit our site for more info: t.ly/swiftlog And our team will answer you as soon as possible. HOW TO CONTACT US? To contact us you can use our email address, social networks, or our discord.

Linny's Forest

Art | Furry

INVITE LINK FIXED! ------- Hi there, welcome to Linny's forest! We are LGBT safe, safe to any fandom (Furry, Soni, Human, any #anime, MLP, etc), have an entry system, and we're almost at 100 members! This server includes: - Points system where you can get free art from me - Draw the person above you - A character trade game - A place to advertise - Very customisable roles - Contests and events!

Bikini Bottom!

Community | Art

Welcome to Bikini Bottom! A new, and growing server! We are a spongebob themed server, obviously, thought we rarely talk about Spongebob, just an aesthetic thing :) We would love to have you! This server is a safe space for all kinds of people. Those who are in the LGBTQ, those who are neurodivergent, those who are just looking for some fun ppl to talk to! We got em. So, if you're a kind and accepting person, please join! You wont regret it ;)

businesscraft

Gaming | Entertainment

You should join the server because we have great mods, admins, and an awesome owner we also have a Minecraft server with a ton of awesome events you can also use this server to chat with your friends and also you can make a business in the server and gain the some Popapo™s which is the server's currency!

The Return of Electro

Music | Entertainment

We are on a mission to be a home for the community of fans who enjoy the musical genre of "Electro," it's sub-genres and the early 2010s! This is also the home to the daily radio show, Exhibition: On A Mission, which plays purely Electro tracks on Truckers.FM. We are also the official discord for the Electrapop subreddit. Things to do: Discover new genres of Electro Listen to our select few 2010's stations Talk about fashions of the 2010s Discuss the early 2010s Way more to list

Munair ♡

Community | Social

Munair is primarily based around Finding Long Lasting Friends, Mental Health Support, Looking for Groups for Games and Hanging out with other Server Members ♡ We are all here for you and we all care about you and we hope you enjoy your stay here!!

Rhododendron Garden

Community | Entertainment

This server is for fun and nonsensitive ppl, if you get hurt easily do not join. We need active and interesting ppl so please join and ill give you a kiss.

Sithum's SMP Join n=Now

Gaming | YouTuber

https://discord.gg/QhFGGHztES https://discord.gg/QhFGGHztES https://discord.gg/QhFGGHztES https://discord.gg/QhFGGHztES https://discord.gg/QhFGGHztES https://discord.gg/QhFGGHztES https://discord.gg/QhFGGHztES https://discord.gg/QhFGGHztES https://discord.gg/QhFGGHztES https://discord.gg/QhFGGHztES

Fitness

Fitness | Community | Social

Fitness Server dedicated in helping you achieve your goals. Join we're waiting for you

Join Now

Fitness

Fitness | Community | Social

Fitness Server dedicated in helping you achieve your goals. Join we're waiting for you

Sacred land

Entertainment | Gaming

Great server for spending time and making friends. Many bots to keep yourself entertained, Lots of memes.

Riley's Riders

LGBT | Gaming

Welcome to Riley's Riders, the ultimate femboy gaming and friend/chatting server owned by Riley Rides! Our server is a safe and inclusive space where we connect with like-minded individuals who share a passion for gaming, chatting, and the beauty of femboys. We're dedicated to creating a positive and welcoming environment for femboy enjoyers, straight people, queer individuals, traps, trans individuals, and gamers alike. We have dedicated channels for different interests from gaming, sharing pics and vids, and sharing music. Additionally, we have channels for chatting, sharing memes, and discussing topics unrelated to gaming. Come join our friendly and welcoming community and be a part of Riley's Riders! Whether you're a hardcore gamer, a femboy enthusiast, straight, or a member of the LGBTQ+ community looking for a supportive space to connect with others and to game with! We welcome you.

Arctic's Gaming Community

Community | Gaming

🌐Discover Arctic's Gaming Community – your ultimate gaming destination! Looking for a vibrant, welcoming community of gamers? Look no further! 🔥Join Arctic's Gaming Community now and connect with like-minded gamers from around the world. With us, you'll find thrilling game nights, engaging discussions, and endless opportunities for collaboration. 👀Don't miss out – level up your gaming experience today with Arctic's Gaming Community!

MIDNIGHT FR

Streaming | Social

le premier serveur fr de MIDNIGHT le jeux d'epic game avec les fantôme et les hunter ! alors viens voir le serveur sans te caché autrement les hunter nous attraperons !

Blitz

Community | Anime

Hello everyone if you want join a server which is half friendly/toxic, and if you want relax for some time join the Blitz Server 1) You can talk and make some new friends in here 2) half friendly and toxic. It'nt no fun for a server with some toxicity. 3) You can try bulid your connection in here. 4) if you are a loner, introvert this is the right place we can help you. 5) Join blitz , we are like one big, strong family

The Paradise Group

Business | Travel

We are the world's first affordable luxury lifestyle community for like-minded individuals. Our goal is to create a huge networking living on Koh Samui, Thailand's most sought-after island destination, where you can live in luxury mansions surrounded by other young business-minded individuals which we offer at a great price! Our community offers a range of services, including private chefs, maids, and access to exclusive facilities such as fitness centers and spas. We believe that living in luxury should not come at a high cost, which is why we have designed our community to be affordable for everyone. If you're interested in learning more about the Paradise Group and joining our community, we would love to schedule a voice call with you

Aruba RolePlay

Gaming | Role-Playing

Jaruwrjegkwgkwykwtketkwtkwfnqfnqfkgkwgkwfjwfjgkegkevmgksvksgmwvmsvmwgjsvnwfnwgksvkwvmsglhlegmsvnwfjwfnfjwfjwfjq

Lagoon 18+ | Gaming Anime Social

Gaming | Social

Looking for a small, but active 18+ server to call home? Join Lagoon and be a part of a community surrounding gaming, anime, and social events where you can make new friends!

VolumeX Community

Community | Gaming

Ich kenne genau die Community, von der du sprichst! Sie ist wirklich großartig und hat eine Menge zu bieten. Die Leute, die dort sind, sind so nett und hilfsbereit. Es ist erstaunlich, wie sie sich bemühen, neue Mitglieder zu begrüßen und zu unterstützen. Die Giveaways sind wirklich großzügig und es gibt immer etwas zu tun. Die Events sind immer sehr gut organisiert und sehr unterhaltsam. Die Minigames sind auch sehr lustig und man kann stundenlang spielen. Ich würde auf jeden Fall jedem empfehlen, sich diese Community anzuschauen! 😃

Obsessive

Community

𝐨𝐛𝐬𝐞𝐬𝐬𝐢𝐯𝐞 𝐨𝐛𝐬𝐞𝐬𝐬𝐢𝐯𝐞 is a new dating server that is welcoming to all. Very new and fresh but we hope you will join and meet great people and partners. ˚✧come meet new people and enjoy your time ˚✧self promo ˚✧looking for staff members ˚✧keep the server a safe place for all ˚✧pfp channels along with other channels for people to learn about you! ˚✧Always looking to improve ˚✧self roles ˚✧dating server --------------------------------------- [https://discord.gg/FeMQvMDfsW]

canvas and co.

Art | Design

˚ ༘✶ ⋆｡˚ ⁀✶ ⋆｡˚ ⁀➷ Canvas & Co. is an art club (community) where art enthusiasts from every realm come together and discuss art. We just started as a community and support from all is really appreciated. We will host art exhibitions every month and art challenges every week. Members can share their art while others will give feedback. Everyone is invited in this magical journey ˚ ༘✶ ⋆｡˚ ⁀➷˚ ༘✶ ⋆｡˚ ⁀

MUSIC ROOM

Music | Social

Music Room è un server a tema musicale in cui puoi confrontarti con altri appassionati di MUSICA ?, in maniera rispettosa e senza pregiudizi. Al momento ci sono le chat dedicate al: ?Rap ?Rock/Metal ?Pop/Rnb ?Kpop Al raggiungimento dei 2500 Membri aggiungeremo la chat dedicata alla musica elettronica. TI ASPETTIAMO ???

Planet Floof!

Furry | Art | LGBT

Heyo! :3c Welcome to Planet Floof! 💗 We are the CUTEST furry social server! Looking for heartwarming souls to fill the void! •ᴗ•

Join Now

Planet Floof!

Furry | Art | LGBT

Heyo! :3c Welcome to Planet Floof! 💗 We are the CUTEST furry social server! Looking for heartwarming souls to fill the void! •ᴗ•

Th Isle Officiel Evrima

Gaming | Growth

- Rassembler et faire vivre la communauté aussi bien sur le discord que sur le serveur est un réel travail qui demande énormément de temps. - Pour ça, nous avons une équipe de passionné ouvert d'esprit et dynamique qui s'applique à faire de ce projet une réalité.

Dami’s chill zone

Community | Gaming

Are you looking for a place to chat and hang in when you’re bored? Well that’s what this server is for we’re trying to build a community for people to be able to make friends and have fun. Just don’t be annoying or “edgy”

Stainlife RP

Gaming | Role-Playing

GTA FIVE M SERVER [NEW] LOOKING FOR POLICE, EMS, FIRE AND STAFF JOIN FOR A SEMI SERIOUS SERVER WITH NO LAG

Marty's Designs

Role-Playing | Design

Are you looking for unique but quality liveries/re-textures for vehicles and EUP for your FiveM server or for your personal needs? Well, look no further! We offer high-quality and great-looking EUPs and Vehicle Liveries. Our development team over here at Marty's Designs only provide the best quality possible to provide to you. So give us a try, join our discord to see if any of our product fits your needs! What do we offer? > - EUP > - Liveries > - EUP, Logos/Patches, EUP Badges, and Livery commissions > - Exclusive, free discord listings

Anime/ Nerdcore Community

Anime | Manga

A server for anime and Nerdcore fans to meet, talk and play games. We have a couple bots to keep the server a bit more interesting. We are always improving!

The AEGIS Alliance

Bot | Memes

A bunch of content bots provided by The AEGIS Alliance that include images, memes, videos, and tweets on various topics.

The Arctic

Social | LGBT

Welcome to The Arctic! We are a newer server that accepts everyone as long as they are respectful! It is ment to be a neutral safespace for all identities, we are also accepting of endogenic systems and any other system orgins. We have: -a objectum category -pluralkit and tupperbox (non systems are allowed to use for other reasons that isnt roleplay) -a radqueer category (and a opt out option for those who dont want to see it) -a sensitive category for possibly triggering topics and vents locked behind a role -a arctic theme -pastel color roles -a manual verification system -a space for littles/age regressors -and room for more!

AVATARS AND BANNERS

Emoji | Community

USA/ENGLAND Hi! Welcome to our server where you can find free png and gif avatars, banners for Discord. You can also find pepo, pandas and cats emotes and much more! The server is in English and Polish. POLAND Hej! Witam Cię na naszym serwerze gdzie znajdziesz darmowe awatary png i gif, banery do Discorda. U nas znajdziesz też emotki pepo, pand i kotów oraz wiele więcej! Serwer prowadzony w języku angielskim i polskim.

del lunaꜝ ♡

Community | Music

⊧　　 sfw ⁁ non tox 　　kpop ♩ kdrama　 ⁺　decor

Stuffies And Puffies

Art | Furry

A server for fat and inflation with furries welcomed aswell as irl pics channel

Matzouni

Gaming | Community

Welcome to Matzouni. Matzouni is a small discord server, we have a Minecraft Server where anybody can join. We also have to offer level rewards in the discord server- at certain levels you will be rewarded, level 50+ you will start to receive in game ranks?. But of course you don't have to join the actual Minecraft Server, you can just hang out with us on Discord. Any further questions? Feel free to ask a Staff Member or check the website https://matzouni.com/

Mori’s Metropolis

Gaming | LGBT

Welcome to Mori’s metropolis! we are a questcraft/Vivecraft/pc vanilla(with the exceptions of the Vivecraft and simple voice chat mod) minecraft server. We are LGBTQ+ and truamagenic system friendly!

The Discord Me team is launching Grivio a new community platform.